DPCstruct | MC12689
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 63 ± 6 aa |
| Standard deviation of domain lengths | 6.49 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 38.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09724 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y3EQB3 | 711-770 | EIETQLSYLYGIALIRDNTSPEVIEYFPSYDLPADRNEQIKLMFEKKRIWKLEQLRPYFP |
| A0A5B7DVW2 | 61-119 | KGLITNLNQLNGLVLLDRSSPATVITYFPASELPLDIKSRLETLFDVQEKWTYDEIRPF |
| Q9LIW8 | 114-174 | None |
| A0A2I0W6T4 | 360-420 | None |
| A0A7R9AEK8 | 9-68 | None |
| A0A822XPJ5 | 70-129 | None |
| A0A183J6P5 | 129-186 | None |
| T1IL49 | 295-354 | None |
| A0A803VV28 | 554-627 | None |
| M2Y2H6 | 278-334 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.