DPCstruct | MC12687
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 410 ± 70 aa |
| Standard deviation of domain lengths | 69.53 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 24.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11573 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L5CN00 | 128-452 | RNRVQEFVKENSPEHWKQSNWHEKHLNFHRKYPEKFAPEGIMEQGGAASSAYNSLPVYFGNVCLRFLPVFDIVIHRYLEIPPVTKSL… |
| A0A7R9K7G3 | 41-373 | EKFAPEGILEQTGGPSSPYHSLPVYFGNVCLRFLPVFDIVIHRYLELPPVTKSLETLLEHLGCLYKFHDRPVTYLYNTLHYYERKLR… |
| Q10669 | 908-1418 | None |
| T1KIW4 | 565-985 | None |
| A0A077W784 | 245-707 | None |
| A0A3M7RWW0 | 5-299 | None |
| A0A6F9DLE4 | 339-826 | None |
| Q55BN0 | 1087-1504 | None |
| A0A4U5P8F2 | 76-612 | None |
| A0A0C2JGI7 | 681-1016 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.