DPCstruct | MC12686
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 116 ± 10 aa |
| Standard deviation of domain lengths | 9.80 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 27.79 |
| Pfam Score | 60.00 |
| Assigned Pfam label(s) | CL0459- PF11411 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067KY67 | 1-114 | MVIENGGTFSMNLNKSVTHCIAAENKGIKYQAAKLHGDVIHCSWVLDCCSQKKLLPLQPKYFLFLSEASKKKLQEEIDEFSDSYYWD… |
| A0A287J6P4 | 105-221 | VVENGGSFSMNLNDSVTHCIAAEKKGIKYQAAIRHGRIIHYSWILDCCKQKLLLRLQPKYILFLADFARHKFPEEIDLYADFYYWDI… |
| A0A507DAE0 | 462-598 | None |
| A0A507CZ80 | 199-297 | None |
| A0A2W1BSD6 | 358-477 | None |
| A0A6A1Q7S2 | 434-550 | None |
| A0A3M6VHF6 | 261-395 | None |
| A0A5J5NR53 | 156-268 | None |
| A0A059CKF0 | 281-393 | None |
| A0A3M7BW31 | 289-405 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.