DPCstruct | MC12685
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 81 ± 6 aa |
| Standard deviation of domain lengths | 6.05 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 49.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A818AYP5 | 11-81 | KCTFIILSKELFDRTHDEIESMIGDVNLFLNDPDDVHCGEIEIMIAEVSARHKGYGIETLYTFIRYGNKLY |
| A0A5F9CAF5 | 334-413 | MQHSWREDGDKCTFIVLDKERWQAQPGAPEESCMAGDVNLFLTDPGDPTLGEIEVMIAEPSCRGKGLGTEAVLAMLSYGV |
| A0A812BGR3 | 54-130 | None |
| A0A7R9JFQ8 | 163-243 | None |
| A0A834XY98 | 53-131 | None |
| A0A0N0U731 | 169-249 | None |
| A0A5F9CXR6 | 334-413 | None |
| A0A182PQL4 | 343-425 | None |
| A0A0V0YG50 | 531-615 | None |
| A0A7R9DGF1 | 1-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.