DPCstruct | MC12683
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 423 ± 65 aa |
| Standard deviation of domain lengths | 65.27 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 64.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.74 |
| Pfam Score | 71.43 |
| Assigned Pfam label(s) | CL0466- CL0229- CL0272 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R2MM62 | 1-395 | MKVMTPSSSPPPERGLPINAAFRPQQTNIMCAEDDDFTSDDDHLEERNAFHILSTLETRPHLYQPREQQGPFSDLNVLKNKPAHLAV… |
| A0A7R9JVN3 | 1-520 | MQNLSIAEVTRRLIASESMSDLSGDACLSKSKNNLGRSSWDMDSPRVTPPGTPPPPYGGGCVNPIEGVEAHHEVDQLHEESVVMTDA… |
| A0A815IZ28 | 410-870 | None |
| A0A4Z2AX51 | 247-606 | None |
| A0A1I8IU28 | 27-505 | None |
| A0A2U1J2W3 | 7-383 | None |
| A0A7D9H7E0 | 62-606 | None |
| A0A4D9DKN7 | 1-329 | None |
| E0VFR4 | 70-518 | None |
| F2UKL5 | 56-451 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.