DPCstruct | MC12682
Metacluster Properties and Pfam Annotations
| Number of structural domains | 43 |
|---|---|
| Mean domain length (aa) | 89 ± 5 aa |
| Standard deviation of domain lengths | 5.04 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 52.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183D3M0 | 3-92 | YCREKVKTVKPYAHGRTLLDLVDLHIMDYLIGNQDRHHYETFAVFVDSPSYSIHLDNGRAFGRTDFDDDDILLPLRQCCVLRPSTFL… |
| A0A7R9JRH3 | 119-206 | YCSLVRDIPPYDTGRRLLDIMDMAVFDFLMGNMDRHHYETFRVFGNDTFPLHLDHGRGFGRPFHDEVSILAPVLQCCLLRQSTLTTLI |
| A0A0L0CQ13 | 485-572 | None |
| A0A1B6JCV6 | 79-172 | None |
| A0A811KLD3 | 341-433 | None |
| A0A6J8E055 | 488-575 | None |
| A0A4U5UJ14 | 161-248 | None |
| A0A7R8H1Y1 | 115-196 | None |
| A0A6L5CHW6 | 218-312 | None |
| A0A835NWR8 | 265-355 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.