DPCstruct | MC12681
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 236 ± 18 aa |
| Standard deviation of domain lengths | 18.46 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 67.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 28.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U0WXJ8 | 474-706 | ATNLSPTKTPSRTPAAINPATPAYKKSVATTRSATPSPVVNRNKTISRVGVQYTDLAKFSIKPPYWLSWTAKEYADFAEALTASFDP… |
| A0A4U0U6L6 | 1-265 | MSGFVASAVRQGVARANGKRRRVERETCEDASSDHHVEPSTPLASCQSEAITPDTPRMGGDTAASISISSDETPCKPSYKRRTEDSP… |
| M2N4G4 | 52-281 | None |
| A0A6A6CEK8 | 37-289 | None |
| A0A139HCJ7 | 5-262 | None |
| A0A2D3V456 | 21-237 | None |
| A0A3M6ZXI1 | 1-233 | None |
| A0A6H0Y1F9 | 1-199 | None |
| A0A1V8TQC3 | 133-371 | None |
| A0A6A6F0K7 | 23-257 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.