DPCstruct | MC1268
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 164 ± 25 aa |
| Standard deviation of domain lengths | 24.85 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z2FJF1 | 20-203 | ALRSAYRLMESAAAARSGGRSGGRTPRVAPELYVVCAEAALQLGCVELSSGCLKRFFEGNPPANQFLCRAYLCRGRLEAPPTTGRAA… |
| A0A3P4LZ58 | 2-156 | ESFSPDLFVLCAEQALKMGHPEMSNDCLQMYFKVKGPVTQFLGRAHLCRAQLCAPKSTENLEEFENCVTQYMKAINFAKGEPRYYFL… |
| A0A0G4HKB8 | 22-204 | None |
| A0A1I8HSU3 | 1-153 | None |
| A0A3B1K4N2 | 18-164 | None |
| S9XCP7 | 49-231 | None |
| T1FAB6 | 11-172 | None |
| A0A024FUI0 | 1-211 | None |
| A0A4W4GD47 | 3-117 | None |
| A0A4W2GU66 | 5-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.