DPCstruct | MC12678
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 641 ± 79 aa |
| Standard deviation of domain lengths | 79.07 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 26.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q4PZI7 | 53-768 | FSPITTVKWGFPNFYRKPGLGYQKLGQHRHRDCFDREWTGDYDDRYISSWDGQVSKLVVQAVDDIFENNTGSTYRRTFIRNIAPVYL… |
| A0A4U0TMD1 | 74-746 | LVVQHSDSIKSKIPWAIRALNWVWGSRLENVNPEVDSNGDGSLFIPSDLEPPIRNGGRYDRVQYRDWCFAHTAKNVLEGMDMYEDEV… |
| A0A284QTR2 | 73-654 | None |
| A0A098DKV6 | 16-679 | None |
| R1GAF7 | 1-546 | None |
| A0A4Q7JTJ5 | 39-652 | None |
| A0A166SGA8 | 13-697 | None |
| A0A4S9C9H1 | 2-634 | None |
| A0A7J6JQF8 | 65-811 | None |
| A0A163FTF6 | 206-922 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.