DPCstruct | MC12676
Metacluster Properties and Pfam Annotations
| Number of structural domains | 75 |
|---|---|
| Mean domain length (aa) | 122 ± 34 aa |
| Standard deviation of domain lengths | 33.93 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 76.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377AGN3 | 5-80 | ERNRPFETREEVLAYHKREKIPCLECGKLLIFLPRHIWFVHGIRADEYRVKWNIPKHIALAGISYLEKQSEYMKAR |
| A0A089NZA4 | 6-116 | ALIAQCHSAISALAYPGSGPVTAAPDLQVRLDKPSAAQVRGSVRPDGIMSFIDGRVYKTLKRHLTAHGLDPQSYRARFGLPGDYPMV… |
| L0KG55 | 4-99 | None |
| A0LDQ3 | 7-151 | None |
| A0A2R7RS48 | 6-82 | None |
| B8IVJ1 | 16-143 | None |
| A0A1E1F2F3 | 13-150 | None |
| A0A6B2FU27 | 227-322 | None |
| B0UNG8 | 19-143 | None |
| A0A1H7MLY5 | 11-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.