DPCstruct | MC12674
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 72 ± 6 aa |
| Standard deviation of domain lengths | 6.39 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 90.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F3RJB9 | 42-103 | YPKRKRLADYYPLTPEDAVILQRMSSRSFNIYFINQLLLKLSNKYPNRHFANKIAVLNYMAK |
| A0A0F3M5I6 | 4-78 | VPKEKLADYYPLTPEDAVILQRMSSRSFNIYFINQLLLKLSNKYPNRHFANKTAVLNYMAKALANELLTTDQANS |
| B3CUZ3 | 115-190 | None |
| A0A2U3RPD0 | 120-195 | None |
| A0A2U3R7J7 | 1-77 | None |
| A0A2U3QWS3 | 278-338 | None |
| A0A2U3R2T3 | 235-309 | None |
| A0A0F3RP73 | 71-146 | None |
| A0A2U3R473 | 42-117 | None |
| A0A0F3RN59 | 1-63 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.