DPCstruct | MC12673
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 73 ± 5 aa |
| Standard deviation of domain lengths | 5.36 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 76.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B3CUZ3 | 218-291 | KAQLKRKIAGVFKADIAYQILTSCDFVAAVKNKYYIKLLKNITLTECDRSKILQAVQDVYGYEIQELQVKPFEQ |
| A0A0F3MB74 | 1-78 | MAYQILTSCSFGPAVRTRFFVKLLKNITLTECDESKILQAVQDVYGYEIQELQVTPFEQLKTVSQKQINEERVSLESQ |
| A0A2U3RRM9 | 9-71 | None |
| A0A2U3RET5 | 45-122 | None |
| A0A2U3R4R8 | 2-76 | None |
| A0A2R8F2N9 | 44-121 | None |
| A0A0F3RK59 | 1-66 | None |
| A0A0F3RP73 | 174-251 | None |
| A0A0F3M5I6 | 106-175 | None |
| A0A2R8F103 | 1-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.