DPCstruct | MC12672
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 95 ± 11 aa |
| Standard deviation of domain lengths | 11.39 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 32.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0413 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A178MTH5 | 38-129 | LRHCPHNQTNTAHPAMIAAVTVGLSDKVVAVHRTYIAANGVGKASITPAKMTLGPIARGAIRLGDVGDRLILAEGIETALSVMQATG… |
| A0A0F3M7R4 | 2-92 | VFDEETQKSWPALTIFVKNDKGEITGAKILALNSKTCNKADVAEKSVGTISGSFAEIAQQNSKYSPVTIITKDIETALTIRQAGVEG… |
| A0A2R8EZI1 | 84-177 | None |
| J0QUV8 | 15-111 | None |
| A0A0F3MKX5 | 18-104 | None |
| A0A0F3MK21 | 1-69 | None |
| A0A0F3RM96 | 169-265 | None |
| A0A7Z1ZF01 | 130-234 | None |
| A0A0F3RJ76 | 31-111 | None |
| A0A2U3QSI7 | 390-483 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.