DPCstruct | MC12671
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 398 ± 67 aa |
| Standard deviation of domain lengths | 66.81 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 23.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q9DAP2 | 11-339 | DDKRNLSSLAEKLNEIANRLGTDASPEAVGQALASTTLQARPESSITLEAFIQGNGLGLPTCHFHLVSLAAAVGDRALQHPLGSFGG… |
| A0A1H0Z101 | 10-438 | QHHAGQLAEYDSLLSQLRKIPTSGIRTDNTYLTPKPFSPLAREFDKGSAHIAEVVQSIGAEVRPDRLLCLTHILKYYGLTVPEHQDA… |
| A0A3R8W7P1 | 17-353 | None |
| A0A7T4REU1 | 2-384 | None |
| A0A0J6INC8 | 2-330 | None |
| A0A4Y9TDV0 | 8-358 | None |
| A0A2G0XB50 | 166-602 | None |
| A0A2G0XBN7 | 2-345 | None |
| A0A7Y8KGU4 | 2-309 | None |
| A0A2K4IHE8 | 10-347 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.