DPCstruct | MC12670
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 281 ± 60 aa |
| Standard deviation of domain lengths | 60.26 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 77.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.74 |
| Pfam Score | 90.50 |
| Assigned Pfam label(s) | CL0644- CL0192 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A197JFM6 | 9-296 | DPCNSAYLRHACSVAYPRPVSSGYGNNYNVLFACKSSCQSVIDSCTANFQLLGMTDMLPNCAAAVPNTDKYPGGPVQFQGDGSCNSL… |
| A0A6J3R240 | 8-281 | VNFDCSRDFRPFVHSMLLFVWNTDMSHFPALGSVRGLTECLKLMEMFGVPWPGDMECSRFPDCDEPYPRLVDVNLAGDPTDGAPVAV… |
| D3B391 | 613-968 | None |
| A0A1W0X791 | 144-449 | None |
| A0A1I8IPF3 | 244-495 | None |
| A0A1D2N8C9 | 12-354 | None |
| G0PC91 | 9-212 | None |
| A0A2W1B0G6 | 34-246 | None |
| A0A183SYX6 | 54-451 | None |
| S9X6G9 | 2-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.