DPCstruct | MC1267
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 72 ± 4 aa |
| Standard deviation of domain lengths | 4.19 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 74.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 58.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02177 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060XYL6 | 7-77 | FLLLWVATLTLASEVPSDDSVGLLAEPQVAMFCGKFNMHVNVQSGKWESDPFGTKSCIGTKEGILQYCQEV |
| A0A4Z2FHI0 | 5-77 | VALLLLAVAASALAAEVPTDVSLGLLAEPQVAMFCGKLNMYINVQSGKWEPDPSGTKSCIGTKEGILQYCQEV |
| A0A3B3VWB7 | 11-81 | None |
| A0A672K3R2 | 17-86 | None |
| A0A673K596 | 13-88 | None |
| A0A6I9MU53 | 10-77 | None |
| A0A673XVF0 | 5-64 | None |
| A0A0S7JU34 | 11-82 | None |
| A0A7J8AE88 | 5-76 | None |
| H9GNC2 | 4-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.