DPCstruct | MC12669
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 61 ± 3 aa |
| Standard deviation of domain lengths | 2.71 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 80.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 68.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08040 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J5YKP1 | 321-378 | MVNFVSLAREHWVNILVPMGFVFGWYLDRLQDTKLTAFRNKSLLFGRELKPGEEVTWK |
| A0A6J3R1S7 | 1-58 | MMNLLPIVGDHWVHILVPIGFVFECPLDRKSGEKLTAFCNKNLLHKRELRPNEEVTWK |
| H0ZQP7 | 60-119 | None |
| A0A4Z2FV75 | 126-183 | None |
| A0A6P7LUD0 | 30-92 | None |
| G7PBB7 | 42-106 | None |
| A0A672TKI5 | 178-240 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.