DPCstruct | MC12668
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 168 ± 25 aa |
| Standard deviation of domain lengths | 25.47 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0115 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J3MDP9 | 12-182 | QPSFWIAVACIVFNPTFWNTAARLEYSNKTITNLAGGNARYGCYGLAVAIFFLGLFRDALYEQALRAQPSHPALLGFVSQALAVGLV… |
| A0A6J3QK85 | 10-201 | PSEPHFVAAVLTIAFNPLFWNVVARWEHKTRKLSGAFGSPHLACCTLGGAILLLNVLRSHCFTQAMLSQPRMQSLDNPLAYGMGLAL… |
| A0A2T7F8W3 | 89-241 | None |
| R7Q789 | 95-297 | None |
| A0A6I8P831 | 28-193 | None |
| A0A452TEM1 | 1-155 | None |
| A0A5J4YR14 | 30-250 | None |
| A0A2Z6M3C9 | 153-315 | None |
| A2DDT3 | 6-160 | None |
| A0A1Q9CTK7 | 6-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.