DPCstruct | MC12664
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 127 ± 10 aa |
| Standard deviation of domain lengths | 10.10 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y1TMP1 | 37-160 | FEVRRTEAFREKSASAEYNPGSLDGTRPGIFYVPIPDVTKYNMYSDESLFLHEAIPGHHYQISLQQENTDLPSFRKTLWYSAYGEGW… |
| A0A536FHK9 | 92-222 | PEPVKRVEAMIAPPGGAAAMYYTRPSEDFKRPGRTWYPTLGKTRFPLWGEVSTAYHEGVPGHHLQLAQLTYMGAELNRFQRVAAFVP… |
| A0A817HSD8 | 227-351 | None |
| A0A6G3VTQ4 | 47-161 | None |
| A0A1Q7HMJ0 | 243-376 | None |
| A0A7Y5TY47 | 309-445 | None |
| A0A7G3D700 | 19-130 | None |
| A0A2V6MDY6 | 41-176 | None |
| A0A538TKL3 | 136-271 | None |
| A0A423SR39 | 115-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.