DPCstruct | MC12663
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 119 ± 13 aa |
| Standard deviation of domain lengths | 12.50 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 27.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J4PGD4 | 3-120 | VRIIEIKSKEQALREFRNVKADEKSFQFMLPKVFGLSMKIREVKARDANIIKQEMLSDGGDATLSKESYDLKNERSDILLMGNLRSY… |
| A0A6I2UGA6 | 1-114 | MQIVQINNANAAAKAMQEIGVTSRGVEIMVEKALFQAIRLERVDTRAANILKQTMLSQGAEAAVSAATINLAAPYTDVLVLATVAQL… |
| A0A5E4KHG7 | 11-145 | None |
| A0A427UE83 | 129-262 | None |
| A0A7X9A3J9 | 1-119 | None |
| A0A0P7GZA9 | 463-570 | None |
| A0A1V4VFH5 | 12-152 | None |
| U2YGM9 | 254-374 | None |
| A0A135VGX4 | 11-131 | None |
| A0A7J2J5I7 | 83-208 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.