DPCstruct | MC12662
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 138 ± 22 aa |
| Standard deviation of domain lengths | 21.72 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 74.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04659 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D3TD18 | 1-114 | MILEMVGDDPKKHIIAMRWLGYMLQFVDHQGLAKILDYYERIGWISSEAKNELKEIAEGLKPTGKGEWKLPFRVHLTSLLFITKIAD… |
| A0A7J4PEI1 | 4-134 | EPVEEEGQREELLVPPPLDKMGIRLTKIKGDAISSRVLMEWMKFLIEKLSFEGMVDVLAYYVDLGWISADVLLKVLKYAKGLKSWQE… |
| A0A831K3W8 | 15-172 | None |
| M0CKG1 | 32-157 | None |
| A0A7C5CMB5 | 174-327 | None |
| W0JTT1 | 242-340 | None |
| A0A3P3RGY0 | 220-309 | None |
| A0A284VI82 | 135-296 | None |
| A0A6G2HI62 | 18-136 | None |
| A0A151EFV8 | 86-248 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.