DPCstruct | MC12659
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 93 ± 3 aa |
| Standard deviation of domain lengths | 2.89 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 82.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 50.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3E0M535 | 1-97 | MFRDFKSGGYSLEGSQLAPQYLSKLIIVIAIAYTSATLQGKKIKDMGIQKYVTRPEKRYKGQRRHSSFYVGQHLYHWLQLHQMFQKN… |
| A0A6M0CFW3 | 75-165 | MGIEEMFRDFKNGGYNKEGTQVKGERLISLTLLITLAYCQSTIVGGKIVKKGVANYVNRPTEKPRKYRRHSHFYTGNRGETWLNGLE… |
| Q10YJ5 | 1-93 | None |
| D8FYX8 | 9-98 | None |
| F4Y321 | 94-185 | None |
| L7E7S0 | 1-94 | None |
| A0A0A1VWX1 | 72-168 | None |
| A0A845WNH8 | 115-205 | None |
| L8NR56 | 1-94 | None |
| A0A5A5RAT3 | 35-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.