DPCstruct | MC12657
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 90 ± 10 aa |
| Standard deviation of domain lengths | 9.65 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 34.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0026 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S2DQN8 | 59-158 | LLVSLGFAAQVCAAAPSASDYGSPATPESPGRLVKVKADTRNINVYDGETVHFVLDDQRIGWNFNTRTREAVLDLETIAPAGTAVGK… |
| A0A239I7J9 | 16-110 | LAGLASACSPLPVTPDFYGAPAAAYPTQRTVVITPATRYVNVEGGETINFAIGDKSFAWQFFATAPRRFDLNFIAPPGLLDHRVEAF… |
| A0A127QEE7 | 11-107 | None |
| A0A0Q7AJD9 | 350-446 | None |
| A0A7Y6NLK1 | 420-510 | None |
| A0A1C9VBA0 | 142-207 | None |
| A0A0Q5HZV0 | 1-93 | None |
| A0A431KD90 | 1-79 | None |
| A0A1V2VB51 | 1-94 | None |
| A0A1F4GBX7 | 2-76 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.