DPCstruct | MC12655
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 66 ± 6 aa |
| Standard deviation of domain lengths | 6.36 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K3ZN64 | 2-72 | SSNTRRCSSCGRDAQFVYTAEFRVGGTSGGIKLLIGEWGELGEKMIPMYVFVCPNCGKVELYATEDLRQRA |
| A0A842M8G3 | 2-70 | RNKTPVKCPNCGSEMTGIGRQTIRTGPVNEAMWLLVYPDVGVPVAFDAYVCEYCGKFELFADENAVKML |
| A0A7Y0Q4Q0 | 2-57 | None |
| A0A535MEH4 | 1-69 | None |
| A0A3N5BAH5 | 42-113 | None |
| A0A537GTD5 | 1-58 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.