DPCstruct | MC12650
Metacluster Properties and Pfam Annotations
| Number of structural domains | 83 |
|---|---|
| Mean domain length (aa) | 163 ± 20 aa |
| Standard deviation of domain lengths | 20.26 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14024 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W1TAK8 | 1-148 | MNDDRFWAIIDQAKGADVVKRLKPILFTLPPAEIQAFGEILAARIAELYRWDIWGIGYIVNGGCSDDGFEYFRLWVVTQGKDFYDRL… |
| L7U4S7 | 1-149 | MSEEVFWDLIARFNWKKSGDDEAVLRPVVTALSKMEVEDIFAFDDILAEKLYALDTREICRGTYRGTLDPDDGGQYISADDFLYSRC… |
| A0A1M7TXX6 | 2-194 | None |
| A0A4R2LUH7 | 131-314 | None |
| A0A2N5ZAK1 | 136-312 | None |
| R7ZNV8 | 51-229 | None |
| A0A4Q7J956 | 1-196 | None |
| A0A1D9PEU5 | 2-166 | None |
| A0A1Y4N2G4 | 43-206 | None |
| A0A495LA27 | 3-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.