DPCstruct | MC1265
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 80 ± 9 aa |
| Standard deviation of domain lengths | 9.33 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 42.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0547 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5SPN5 | 303-366 | FGIYEKESKVCANCHEECEGGCYGSDSSNCVRCKNVKDGPYCVATCPSSKYNNNGECENCHGNC |
| A0A4Z2F6S9 | 1-87 | MSIREMREFANGSVCLECDSQCEKMDGNTMSCFGQGPDQCVKCLHFKDGPNCVEKCPDGLQGANSFIFKYAKANNECHPCHANCTQG |
| A0A5J5CD76 | 254-337 | None |
| A0A7E4RXR1 | 467-536 | None |
| H3A7N7 | 1-99 | None |
| A0A1I8N9Y6 | 432-505 | None |
| A0A2G9S8M9 | 151-232 | None |
| S4RZ00 | 546-628 | None |
| A0A7J7JI96 | 128-195 | None |
| S4RA78 | 250-330 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.