DPCstruct | MC12649
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 123 ± 11 aa |
| Standard deviation of domain lengths | 10.69 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 74.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 35.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q2Y1R1 | 1-109 | MSPDKIFLRQWTVSLLEAAMADLALEMERIGKMQLFAILRPLLELDGEHGQQEKDAQAAGMSYSAFRVALTRLRRRFGVIIREKVAD… |
| A0A7W1JBI0 | 4-119 | AVVDPAAPAVPDPAFDRDWADVLLARAGDRLAAEHATPGERARYERLAHFVTTNGTSASYAAAGALLGLTEGAVKVAVHRLRQRLRD… |
| A0A645IKZ2 | 24-143 | None |
| A0A150PW44 | 6-115 | None |
| A0A1G3A5C2 | 56-174 | None |
| A0A354T872 | 21-132 | None |
| A0A1W9LH84 | 42-158 | None |
| A0A522S1B8 | 318-460 | None |
| A0A3E0NNK1 | 319-451 | None |
| A0A7C3HGZ3 | 83-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.