DPCstruct | MC12645
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 205 ± 7 aa |
| Standard deviation of domain lengths | 6.62 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 66.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 44.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9REI6 | 2-208 | ELARLKEQYLLLKGSAVESHATGDPLKIIPAHDQQGVLKSMLKRTSLSHWIRKDNSNIGYGSSHGNDHTVCKEHSVDIARLKVENAT… |
| A0A6P5X9H3 | 41-242 | ELQRNLLQVTNEKVNALLELAQLKRKYQLLQEKISNDMKQGNVLAEVTTEELLIMKGMEDARGNEAEAQQNSTDFARMRIENASLKE… |
| A0A4S8JJI5 | 74-285 | None |
| A0A2P2MFQ4 | 29-230 | None |
| A0A6P6GHA1 | 232-449 | None |
| A0A1J3HAB8 | 150-342 | None |
| A0A1D6PMV3 | 23-231 | None |
| M0WP72 | 175-376 | None |
| A0A438HDF3 | 1-203 | None |
| A0A0D2V6Q9 | 317-516 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.