DPCstruct | MC12644
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 134 ± 16 aa |
| Standard deviation of domain lengths | 15.81 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 74.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 39.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F4JKX4 | 1-106 | MASSQNTSDTSSRQYETTEPSLDENIDALLEEEETLITAHRKEIEDTMEIVHEEMKLLAKVDRPGSMIDNYVTQLSFVLSRKAAGLV… |
| A0A0A9RD73 | 1-136 | MAQNIAEVPDAMYQQGRQLARKAKDSSLENNMRNSIAYPIRRAEPDDEDEHLNDLLQVEEEDLVSAHRKQVEETLNILIEEMNMLGE… |
| A0A7S0X0S6 | 1-142 | None |
| A0A6I9MMI9 | 128-294 | None |
| A0A835RAE0 | 41-169 | None |
| A0A6A3BB94 | 167-295 | None |
| A0A7J8PY25 | 113-246 | None |
| A0A2K3LBG7 | 215-345 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.