DPCstruct | MC12643
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 61 ± 5 aa |
| Standard deviation of domain lengths | 4.75 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 94.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.97 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 67.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0270 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G3VK28 | 54-116 | MYNVNKSIEDFARASFNYGLQRNYPVYLSTKNTIMKAYDGAFKDIFSDVFEKEFKAEFDAAGL |
| A0A0A9RBD6 | 1-64 | MYNTDESIRAFAAASMTTAYEKKWPLYLSTKNTILKKYDGRFKDIFQEVYDTDWKSKFEAAGIW |
| A0A804R330 | 89-146 | None |
| A0A6A2XU88 | 156-221 | None |
| A0A4T9W7G1 | 82-147 | None |
| A0A7J6Q2M8 | 248-311 | None |
| A0A7R8XG80 | 531-585 | None |
| A0A146H4F3 | 905-967 | None |
| A0A3Q8UC38 | 96-150 | None |
| A0A388Q760 | 1-53 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.