DPCstruct | MC12642
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 104 ± 9 aa |
| Standard deviation of domain lengths | 8.55 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 68.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 40.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01412 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9R6V8 | 1-95 | MSTFSTQEVEALQKGGNQRAKESFLKDFDTQKMRLPDNSNVDSLREFIKTVYVERRYAHGRFSERPPRDKQNQKVHEEEHRRASSYH… |
| A0A6J3AMD6 | 1-106 | MTTFTQQEIEFLQKHGNEVCKQIWLGLFDDRSSAIPDFRDPQKVKEFLQEKYEKKRWYVPPEQAKVVASVHASISGSSASSTSSTPE… |
| A0A165YJI5 | 1-102 | None |
| A0A0L9V0N2 | 1-115 | None |
| A0A438DH79 | 1-108 | None |
| A0A7J8M0B4 | 1-118 | None |
| A0A1U8G653 | 1-108 | None |
| A0A2I0BGL5 | 101-193 | None |
| A0A6L2KCK0 | 19-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.