DPCstruct | MC12641
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 98 ± 8 aa |
| Standard deviation of domain lengths | 8.13 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 29.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17944 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A831PSC6 | 72-165 | FMVGAYQEILGDMHNLFGDTDSVNVVLNADGSFHLESTHRGDTVDGLLRYVSFTPEVLMEAYRAKVAASDLDEPSRKRFLNALADGL… |
| A0A0A9R4N2 | 3-89 | LGGAYQEALGGLHNLFGGPSVVRVSQSDGPHCFAVTRAAAGPSCADVLRSMQHEPEVMFEVLKQRTDGTTAAALARAFGAMPYLVFD |
| A0A0R2RB47 | 1-83 | None |
| A0A378VTN8 | 3-95 | None |
| A0A218X6L9 | 1-106 | None |
| A0A059LMJ7 | 97-211 | None |
| A0A847BGZ7 | 132-225 | None |
| A0A835UI93 | 223-313 | None |
| A0A7I4B9U6 | 639-750 | None |
| A0A7W1H7K5 | 142-242 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.