DPCstruct | MC12640
Metacluster Properties and Pfam Annotations
| Number of structural domains | 99 |
|---|---|
| Mean domain length (aa) | 205 ± 45 aa |
| Standard deviation of domain lengths | 44.71 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 80.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 25.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0031- PF10187- CL0027- PF12017 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4VIV0 | 186-407 | RLARGVHGGKLLDDSDAHRQIGPINHARWLTLATRLLRVYIGSPSPTAELTELVEFLMGHYIPMWFHIRANSTCTSGALNVMRSIEL… |
| A0A5N4B741 | 10-243 | VDEKLSKRSPGKMVHSRWLTTANRILRLYVSTDEPSENLVILVTFILKVYAPMWFIIKSKPSCLQGAFNVWKMIQLSRYLPKNLKDV… |
| T1FBS3 | 56-309 | None |
| A0A4Y2A7E7 | 11-172 | None |
| A0A4Y2A5P9 | 22-181 | None |
| A0A6S7IJJ8 | 182-482 | None |
| A0A4C1U6C0 | 300-505 | None |
| A0A4Y2CM25 | 47-218 | None |
| A0A4Y2CH24 | 20-228 | None |
| A0A4Y2URE4 | 3-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.