DPCstruct | MC1264
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 136 ± 16 aa |
| Standard deviation of domain lengths | 15.93 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 37.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834BWH0 | 18-149 | TDRDASIDILHSIVRRDVQENDEEAVRVKEQSILELGTLLAKTGQAAELGGLLKFVRPFLISISKAKAARLVRSLLDLFLDMEAATG… |
| A0A4Z2F4L2 | 2-152 | AAAAVVEFQRAQSLISTDSSASIDILHSIVRRDVQENDEEAVRVKEQSILELGSLLAKTGQAAELGGLLKFVRPFLISISKAKAARL… |
| M9LK50 | 21-150 | None |
| F0XTV6 | 19-149 | None |
| A0A6A6LQI4 | 48-176 | None |
| A0A182T3L6 | 14-146 | None |
| A0A3P7QAE1 | 1-111 | None |
| A0A448X910 | 1-142 | None |
| A0A803L5R6 | 17-145 | None |
| A0A0F8ATP4 | 1-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.