DPCstruct | MC12636
Metacluster Properties and Pfam Annotations
| Number of structural domains | 98 |
|---|---|
| Mean domain length (aa) | 113 ± 14 aa |
| Standard deviation of domain lengths | 13.78 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 30.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C4LLV0 | 124-231 | RNFVSWSRREQPWMVLHELAHAYHHRVLGARHPGLLNTFQQAKQAKLYESVKYIRGETRRAYALTNADEYFAELTEAYFGKNDFFPF… |
| A0A2Z3YSF2 | 9-115 | LTQPQDFIQGFGRGNVLLHELAHAFDDRRYGMQNPAVQEAFEQARREGLYQDGEWTPYAVTNAREYFAELSSAYFLRMTAPPLDRAR… |
| A0A6C2TVB0 | 901-1007 | None |
| A0A2E5FLM4 | 162-264 | None |
| A0A517NYM5 | 686-799 | None |
| A0A7R9U5S2 | 203-316 | None |
| A0A7S4PPH9 | 333-450 | None |
| A0A1H4ATI9 | 817-925 | None |
| A0A317ZK33 | 639-750 | None |
| H8MGD2 | 31-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.