DPCstruct | MC12635
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 93 ± 7 aa |
| Standard deviation of domain lengths | 6.82 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 57.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0477 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N7YDA4 | 85-165 | DLFAEPVEGGLRRRDAITHAGLTHFQSAYPGDSISKEDLFYYVYGILHSPDYRERFADNLSKELPRIPAVKKAADFWAFSK |
| A0A0J1DJK6 | 1-100 | MLGITVRDSRNQLSLFDEVGRGEYERQDGVSNSILQRAKTQYGKRVTKEDIFFYVYGLLHSQYFRSRFSVDLQKMLARIPFVTSKDD… |
| A0A2N5IEV2 | 535-625 | None |
| A0A0Q4IUW7 | 1-93 | None |
| A0A7W4P792 | 93-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.