DPCstruct | MC12632
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 126 ± 18 aa |
| Standard deviation of domain lengths | 18.14 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.02 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0491 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R9PB11 | 4-119 | IPSRLAQTTAISRTLEEARKRSTALYRNFYRSAPEICALYALDVPPSTLRAKFRTQFEKNKTVSDLAVLDLMLLKAQQEYQETMNGW… |
| A0A151JZ23 | 4-118 | RATSVVRQVKPILSINREDARRKVLTLYKAWIRQVPISMLTYDIPKNEVDCKQKIREEFKRHAHLTDLRIIDKLIIKGQMELQEVAN… |
| A0A2K6BGR0 | 1-106 | None |
| A0A7E4ZPV9 | 120-247 | None |
| A0A7R9XSC9 | 30-207 | None |
| F4PSF5 | 6-138 | None |
| A0A1S8VWB8 | 4-92 | None |
| A0A5J4YPU8 | 55-187 | None |
| A0A4S8YHZ4 | 43-185 | None |
| A0A151GL61 | 1-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.