DPCstruct | MC12631
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 274 ± 40 aa |
| Standard deviation of domain lengths | 40.23 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 89.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 25.98 |
| Pfam Score | 95.83 |
| Assigned Pfam label(s) | CL0344- CL0277 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W2C411 | 623-949 | DGPEARAIWRIREDGAGLAGRTLDGAQAWPGLEDAAVPVEHLGAYLRDLDALLTEHGLAGSPYGHFGDGCVHVRVDVPLHAGGAALR… |
| R7JLP9 | 12-254 | LARHGYEDACIYGHALEGNYHFILNQSFHTDEEVKRYEDLMNDVKTLVVDKYDGSLKAEHGTGRNMAPFVRYEWGDDAFELMKSIKQ… |
| A0A0B8PHA5 | 153-412 | None |
| A0A7Z9ZIU0 | 56-350 | None |
| A0A0R3QIX1 | 2-236 | None |
| A0A7C5N3K8 | 346-664 | None |
| A0A212DP82 | 1-299 | None |
| A0A0B8P0W4 | 13-227 | None |
| X7Y9I1 | 1-275 | None |
| A0A419VS03 | 139-350 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.