DPCstruct | MC12630
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 569 ± 43 aa |
| Standard deviation of domain lengths | 42.71 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 67.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E2VU81 | 1-585 | MEARRLLILVTIITGFFATIPSLAEAYAIETHANITAAVLETYQQKYGTETFARSDVLQIIDGSIREDDSIRYLNHFYDPINERGLR… |
| A0A0G1UB84 | 6-612 | VLAFDNGTTHPALTSEIVDFYNSLHSEHQITSEQKDWIILGSKEEDTPPRWLNHFYDPVRQTGWTGLKAGTFSPDAFYRAAVAGNAG… |
| A0A7C4EQV8 | 1-608 | None |
| A0A2M6WU32 | 5-568 | None |
| A0A7T5RJY1 | 11-532 | None |
| A0A7C2G7S8 | 1-622 | None |
| A0A2M6W5J0 | 25-643 | None |
| A0A554MCW5 | 1-560 | None |
| A0A0G0GP26 | 10-597 | None |
| A0A7T9KA94 | 11-598 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.