DPCstruct | MC1263
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 155 ± 10 aa |
| Standard deviation of domain lengths | 9.71 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B0DLM6 | 15-169 | TSLVGSINNLLETLDKDESVRNSIENSIIRIADHSPNEVLQSIYDFRQRQTKLSEVNVSTILRIVEHVTCTTKAQECLNEATIQRIS… |
| A0A4Z2F3L0 | 4-157 | TDVEQVTLALLDAATDKDPEVQEQVRKSVLTLGKQQPDRVLAMCQDYLLKHPKLAVSHRVVILQTIELIVGCRIEEISSARIKSLIS… |
| A0A0A8YTB9 | 6-165 | None |
| A0A2P5B4M0 | 1-139 | None |
| A0A402F4Y3 | 134-313 | None |
| A0A182EKS5 | 2-154 | None |
| L9KLT3 | 5-152 | None |
| A0A1V4JZF5 | 1-154 | None |
| A0A438EJU9 | 1-158 | None |
| H2XWN0 | 8-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.