DPCstruct | MC12628
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 87 ± 9 aa |
| Standard deviation of domain lengths | 9.10 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 41.26 |
| Pfam Score | 80.00 |
| Assigned Pfam label(s) | PF03999- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3R7W8 | 132-217 | GRACVRYDTMCVLGVSLNVKEQVLASVWQLTNLPMDCNQILAIPRPVGGILLVATNELIYLNQSVPPCGISLNSCMDGFTKFPLKD |
| A0A1S4ERZ0 | 1-81 | RIAVRKDTCSMVSVSLNIQQRVYPVIWSVSNLPFDCIQALPVRKPLGGTLILTNNALIYLNQSIPPYGVSLNSIADASTSF |
| A0A7R9HTM6 | 8-88 | None |
| D0NYC4 | 133-226 | None |
| A0A2R7W5K4 | 4-84 | None |
| A0A2U1J8T1 | 270-353 | None |
| A0A7R9P0I5 | 364-484 | None |
| A0A6I9YKR5 | 67-155 | None |
| A0A507BVQ0 | 11-102 | None |
| G4VC18 | 238-325 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.