DPCstruct | MC12627
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 169 ± 2 aa |
| Standard deviation of domain lengths | 1.60 |
| Length coefficient of variation | 0.01 |
| Mean AlphaFold2 pLDDT confidence score | 87.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 51.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05041 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S4ERY3 | 1-169 | MLQVFDFRKVLISYYVRSIIYYASNAAKLEDWLSNPAILAALQGTLDRSFVDLDPVFNMNIDEDYDFRSSGITRNSYCSNYLDWIHY… |
| A0A6A5HPC1 | 100-271 | LLQVHELRRLLVTLYIKCIIYYTFTSHKFRQWLREEVVSNSIKSVIENQRYTDVDSLFCPTNDEDYDNAESGISRSSFKSVYLSWMM… |
| A0A151P9C1 | 201-368 | None |
| E9PSU6 | 1688-1855 | None |
| A0A368FR93 | 39-210 | None |
| A0A817UVZ7 | 294-460 | None |
| A0A6J1W687 | 168-335 | None |
| A0A834BG28 | 1-168 | None |
| A0A821D6G2 | 304-470 | None |
| Q98UF7 | 1095-1262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.