DPCstruct | MC12626
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 263 ± 21 aa |
| Standard deviation of domain lengths | 20.74 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 39.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2L0A448 | 3-243 | RISKELEKKRSHPDRLHPELWFNDPGEMNDGPLCRCSLKAQRSGIRHGYYVGEDNLNKCDPWTNNADRLHHYLITISPPTNFLIKTP… |
| A0A1S4ERE9 | 1-228 | CSHCASNPTVSSGSESSSDSSSGEEDAEEDNWMMELQLKQNHPDRLHPELWFNDKGEMNDGPLCRCSSKSRRSGIRHNIYAGEDEQA… |
| A0A1D2N843 | 701-975 | None |
| T1GFQ1 | 187-405 | None |
| A0A7M5WV07 | 263-541 | None |
| A0A813YRP9 | 246-513 | None |
| A0A182G549 | 319-581 | None |
| A0A183A920 | 43-337 | None |
| A0A7R8ZDZ4 | 170-429 | None |
| A0A821TE47 | 276-549 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.