DPCstruct | MC12625
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 235 ± 8 aa |
| Standard deviation of domain lengths | 8.38 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 76.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 30.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S4ER96 | 3-231 | FCEVLVQTLGFDWVLLFLQTHLHTSTVILGMRILLVLGCAPSLVQRFREGSSNGGWLTDVEFHLAHNKMSVLASPQVSKSRDLRHEA… |
| A0A1S3PKK4 | 305-536 | CEELVRTLGFDWLLMFMEEHLHSSSVTAALWILVVLLSNQPILTKFKEGLTGGGWLDHTDSVLTNKIGTVLGFNVGRSAGGHSTLRE… |
| A0A0E4G8K8 | 35-266 | None |
| A0A1B0CUU5 | 859-1100 | None |
| A0A060Z400 | 56-300 | None |
| A0A0K0D4C5 | 1-234 | None |
| A0A7R8WLG5 | 116-365 | None |
| A0A0R3R0H0 | 108-339 | None |
| A0A812BD92 | 346-583 | None |
| A0A0S7KB73 | 292-510 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.