DPCstruct | MC12623
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 171 ± 28 aa |
| Standard deviation of domain lengths | 28.44 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S4EEY0 | 16-187 | LSDDQKKKNIEKEVKVFKEVHDSLSDRPNENIEIPKFFISLPKPEDSLGIKLLEDARSRHLNKISKDLLDHNELKDLYSLLCQHQSV… |
| A0A1D6J2E3 | 51-217 | EALMELETKRILLEIFKERQRKSAEAGSIPSFYKKKPEEGSISSRVQRLAKYRFLKKQSELLLNADDLDAMWVCLRENCVIDDATGA… |
| A0A812P3M4 | 8-164 | None |
| A0A6I9PIJ8 | 25-194 | None |
| A0A1D2NEX2 | 1-203 | None |
| A0A388KKX2 | 243-436 | None |
| A0A3Q1ETT1 | 27-170 | None |
| A0A0R3TGG9 | 6-121 | None |
| W7TMA7 | 53-275 | None |
| A0A812BA91 | 40-212 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.