DPCstruct | MC12622
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 85 ± 6 aa |
| Standard deviation of domain lengths | 5.77 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q7TFR2 | 134-219 | MEYICKELNQPVTFPVRAALVRQSCSQLLWLLKKSNRYSLTIWTGKNDNYSTEDLLCIRDFFDKKQVFYDILEPQNHEFKQAIGVK |
| A0A1S4EDM5 | 1-83 | MLKTLNRNKVLTPVTFPVRAVFATQSIELLQFLIDTSPLGSSLTIWMSTDSDKVCISKLKDLIRTIGKDRIFLDVPEFIREKL |
| A0A7M5XD71 | 298-378 | None |
| A0A6J2YL28 | 1-86 | None |
| T1JIN1 | 245-327 | None |
| A0A3L8S6S6 | 1-83 | None |
| A0A4Y2J3J4 | 1-85 | None |
| T1GB54 | 162-248 | None |
| A0A162SJN3 | 521-608 | None |
| A0A443SNS7 | 219-298 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.