DPCstruct | MC12620
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 63 ± 4 aa |
| Standard deviation of domain lengths | 4.06 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 59.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F4WJD6 | 644-706 | ATFASWDVDYVKLDGCYSHPVDMDRGYPEFGYLLNQTGKHMIYSCSWPVYQIYAGMKPNYTSI |
| A0A1S4EAC0 | 1-67 | MKLDAQTFADWEVDYVKLDGCYASVFTMDEGYREFGKYLNETGRPMVYSCSLPAYQEERKMEVCIFF |
| A0A4C1WHC8 | 37-105 | None |
| A0A2A6CS68 | 421-483 | None |
| A0A2T7PNT9 | 82-142 | None |
| A0A7R8ZF45 | 43-103 | None |
| A0A7R8ZPL1 | 63-123 | None |
| A7T6L9 | 1-69 | None |
| C5LZ02 | 102-155 | None |
| A0A3P7XEB9 | 1-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.