DPCstruct | MC12619
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 124 ± 14 aa |
| Standard deviation of domain lengths | 14.19 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 23.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182WNE0 | 5-126 | TDSFGFNETKLFQVARDCSPDDHKHTQNLVDSKDDMLFVWNAKNCCILVLNWRAAASRKKDGLKHQTLIPSAPQNFTVEKILPSTDG… |
| A0A1S4E7C8 | 1-144 | MDSLGLKNETILHNLGVKCAEIQSDSVKSLIQCVENCLFVFNPDDSSIVVTNLSREPTLYQTLVPSPAPPFQVTSFRVNSTLTYCAY… |
| A0A1I7WBX9 | 5-122 | None |
| D7LYD0 | 11-134 | None |
| A0A6H5HM34 | 465-577 | None |
| A0A6N2AYD8 | 1-144 | None |
| Q8CAD9 | 18-161 | None |
| A0A1B0GCT4 | 9-130 | None |
| A0A6P6XWM8 | 11-139 | None |
| A0A7J7CWE7 | 30-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.