DPCstruct | MC12618
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 78 ± 2 aa |
| Standard deviation of domain lengths | 2.18 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 82.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 46.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14913 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3DU44 | 1-79 | NIVVRTKNKKYFKVLPVLELRRLNLQPDMKLLSYRHEFNSLIIRYMKPPELVAMEKQVYDMVRSLKMTNQKQDLPCKQS |
| A0A818VTF7 | 136-211 | ILRTTNKKYFKRFSIADLDRLNLPLEENNLSYSHANNTLIISYKKPKAILDLEKQVHDELKKLNMKKEGDSDCPVS |
| A0A2P8Z2E7 | 96-171 | None |
| A0A6J3I5S1 | 48-124 | None |
| A0A7S1EEV7 | 116-191 | None |
| A0A498LAD5 | 1-82 | None |
| A0A817E2I1 | 627-701 | None |
| A0A1D1VRA1 | 1-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.