DPCstruct | MC12616
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 110 ± 8 aa |
| Standard deviation of domain lengths | 8.02 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 48.21 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | PF04992- PF04998 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G2WXT7 | 90-200 | QRLVLNAQKTFKIDFRRPSDMHPMEIVEVVDKLQERLKVVPGDDYLSMAAQKNATLFLNILLHSGLASKKVLKEYRLSQEAFEWVVG… |
| A0A6J3ENL9 | 11-109 | IWNAQKIFHINSRLPSDLHPVKVVEGVKELSRKLVIVNGEDPLSRQAQENATLLFNIHLRATLCSRRMAEEFHLSGEAFDWLLGEIE… |
| A0A819MJ77 | 194-292 | None |
| A0A2G8RN12 | 90-202 | None |
| A0A835UWF7 | 4-116 | None |
| A0A2S2PS89 | 219-317 | None |
| A0A820JWI7 | 32-147 | None |
| A0A3S5B943 | 350-468 | None |
| A0A7S2K6R8 | 40-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.